PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06937.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 433aa    MW: 47037.1 Da    PI: 7.0607
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06937.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.21.2e-062355335
                      zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                                  +r C+ + + +++++C  ++ +lC+ C  + H+
  Zmw_sc06937.1.g00030.1.am.mk 23 ARSCDGCMRRRARWHCPADDAYLCQACDAAVHS 55
                                  578*************************99995 PP

2CCT64.23.8e-22330373144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   Rea+++RY+eKr+tR+F Kki Ye+RK +Ae+RpR+KGrFvk++
  Zmw_sc06937.1.g00030.1.am.mk 330 REARVSRYREKRRTRLFAKKILYEVRKLNAEKRPRMKGRFVKRT 373
                                   9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.2712168IPR000315B-box-type zinc finger
SMARTSM003366.6E-72168IPR000315B-box-type zinc finger
CDDcd000212.91E-82468No hitNo description
PROSITE profilePS5101715.338330372IPR010402CCT domain
PfamPF062032.2E-17330372IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MTNAGTAAAA AVATGAALGA RTARSCDGCM RRRARWHCPA DDAYLCQACD AAVHSANPLA  60
RRHLRFRLPT ASSSSALQDP DAPTWLHGLK RGPRTPRSKP GSKHEAMCAT MAAVSSSAVP  120
DLEAEDSGSG IVGDNEHGLE DDDDDLLYRV PVFDPTLAEL YNPTADEGEE QKPACLISSL  180
VETSPDFASG SGQKNELSAF DVPDMELASF AADMESLLMG VEDGLDDLGF LDDEKPQVNV  240
DLGTDLEVAA APAPEREDKK RKRPQMILKL DYEGVIASWA RDGGSLWFHG ERQPHLDPGD  300
SWPDFSVSTT AVIVRGGIVG NVTAVTGGER EARVSRYREK RRTRLFAKKI LYEVRKLNAE  360
KRPRMKGRFV KRTALPQLPQ PSQQQKPQRA PPPAGMVLAP KMGVQCTGAS DFKTRGVRAC  420
KMHHCTCMRP KHD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982006.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLK4AAN00.0K4AAN0_SETIT; Uncharacterized protein
STRINGSi035937m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100042228